PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B00923.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 211aa    MW: 23080.1 Da    PI: 4.175
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B00923.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB110.31.1e-3449141396
             NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                       +  +++Pi n++ri++++lP +aki++da e++qec+sefi+ vtsea++k++ + r  i+ +d++ a+++lG++dyvepl+v+l+kyr ++ 
  Migut.B00923.1.p  49 DAYQYMPIVNIVRILRRALP-HAKIADDANEIIQECISEFIAIVTSEANEKARSQYRTIITLEDVIAAIGSLGLDDYVEPLTVFLNKYRAADP 140
                       66789***************.69******************************************************************9876 PP

             NF-YB  96 e 96 
                       e
  Migut.B00923.1.p 141 E 141
                       6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-3151143IPR009072Histone-fold
PfamPF008083.8E-1453116IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.12E-2653142IPR009072Histone-fold
PRINTSPR006152.1E-108098No hitNo description
PRINTSPR006152.1E-1099117No hitNo description
PRINTSPR006152.1E-10118136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MLLNIYIYNS FISGTINQEA ADRAGAAANL PTTNAGDQNL ASPQSWRRDA YQYMPIVNIV  60
RILRRALPHA KIADDANEII QECISEFIAI VTSEANEKAR SQYRTIITLE DVIAAIGSLG  120
LDDYVEPLTV FLNKYRAADP ERGTSMQVQL AMAMCSTGQQ PSTTPVAQLV PPPPPTPSVI  180
TGDGPMIVDD NEEVDPDEYI GFTEVIRKYF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-2653136892NF-YB
4awl_B6e-2653136993NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-2653136993NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857928.11e-144PREDICTED: nuclear transcription factor Y subunit B-9-like
TrEMBLA0A022RJH12e-70A0A022RJH1_ERYGU; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-37NF-YB family protein